PDB entry 3qjm

View 3qjm on RCSB PDB site
Description: Structural flexibility of Shank PDZ domain is important for its binding to different ligands
Class: protein binding
Keywords: PDZ domain, Protein-protein interaction, Beta-PIX, PROTEIN BINDING
Deposited on 2011-01-30, released 2011-04-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.236
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 and multiple ankyrin repeat domains protein 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: shank1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3qjma_
  • Chain 'B':
    Compound: SH3 and multiple ankyrin repeat domains protein 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: shank1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3qjmb_
  • Chain 'C':
    Compound: Beta-PIX
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3QJM (0-4)
  • Chain 'D':
    Compound: Beta-PIX
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3QJM (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3qjmA (A:)
gsdyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawr
aglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpdmdeavhk

    Sequence, based on observed residues (ATOM records): (download) 
    >3qjmA (A:)
dyiikektvllqkkdsegfgfvlrgaieeftptpafpalqylesvdeggvawraglrmgd
flievngqnvvkvghrqvvnmirqggntlmvkvvmvtr

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3qjmB (B:)
gsdyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvawr
aglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtrhpdmdeavhk

    Sequence, based on observed residues (ATOM records): (download) 
    >3qjmB (B:)
gsdyiikektvllqkkdsegfgfvlrgaeftptpafpalqylesvdeggvawraglrmgd
flievngqnvvkvghrqvvnmirqggntlmvkvvmvtr

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.