PDB entry 3qhw
View 3qhw on RCSB PDB site
Description: Structure of a pCDK2/CyclinA transition-state mimic
Class: transferase/protein binding
Keywords: kinase catalytic domain, protein kinase, Cyclin, Phosphorylated Thr-160, Phosphorylated on Thr-160, TRANSFERASE-PROTEIN BINDING complex
Deposited on
2011-01-26, released
2011-05-25
The last revision prior to the SCOPe 2.02 freeze date was dated
2011-05-25, with a file datestamp of
2011-05-20.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.189
AEROSPACI score: 0.48
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cell division protein kinase 2
Species: Homo sapiens [TaxId:9606]
Gene: CDK2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3qhwa_ - Chain 'B':
Compound: Cyclin-A2
Species: Mus musculus [TaxId:10090]
Gene: Ccna2, Ccna, Cyca
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Cell division protein kinase 2
Species: Homo sapiens [TaxId:9606]
Gene: CDK2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3qhwc_ - Chain 'D':
Compound: Cyclin-A2
Species: Mus musculus [TaxId:10090]
Gene: Ccna2, Ccna, Cyca
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: CDK2 substrate peptide: PKTPKKAKKL
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: CDK2 substrate peptide: PKTPKKAKKL
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: CDK2 substrate peptide: PKTPKKAKKL
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: CDK2 substrate peptide: PKTPKKAKKL
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: ADP, MG, MGF, CL, DTU, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3qhwA (A:)
ghmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
nhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafc
hshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3qhwC (C:)
ghmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
nhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafc
hshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
- Chain 'D':
No sequence available.
- Chain 'J':
No sequence available.
- Chain 'K':
No sequence available.
- Chain 'L':
No sequence available.
- Chain 'M':
No sequence available.