PDB entry 3pwu

View 3pwu on RCSB PDB site
Description: An immmunodominant CTL epitope from rinderpest virus presented by cattle MHC class I molecule N*01801(BoLA-A11)
Class: immune system
Keywords: MHC BoLA conformation, immunodominant epitope cattle, IMMUNE SYSTEM
Deposited on 2010-12-09, released 2011-08-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: MHC class I antigen
  Species: Bos taurus [TaxId:9913]
  Gene: LA-A11
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q95477 (0-273)
• Chain 'B':
  Compound: Beta-2-microglobulin
  Species: Mus musculus [TaxId:10090]
  Gene: B2M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.02: d3pwub_
• Chain 'C':
  Compound: IPA from Hemagglutinin glycoprotein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41355 (0-8)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3pwuB (B:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'C':
  No sequence available.