PDB entry 3pwb

View 3pwb on RCSB PDB site
Description: Bovine trypsin variant X(tripleGlu217Ile227) in complex with small molecule inhibitor
Class: hydrolase
Keywords: trypsin-like serine protease, hydrolase, protein binding, duodenum
Deposited on 2010-12-08, released 2011-12-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.16
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (78)
      • engineered mutation (80)
      • engineered mutation (151-154)
      • engineered mutation (171)
      • engineered mutation (194)
      • engineered mutation (204)
    Domains in SCOPe 2.02: d3pwba_
  • Heterogens: CA, BEN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3pwbA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdsggp
vvcsgklqgivswgegcaqknkpgiytkvcnyvswikqtiasn