PDB entry 3pu7

View 3pu7 on RCSB PDB site
Description: Cu-Zn Tomato Chloroplast Superoxide Dismutase
Class: oxidoreductase
Keywords: oxidoreductase, antioxidant, metal-binding, chloroplast, disulfide bond, transit peptide
Deposited on 2010-12-03, released 2011-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn], chloroplastic
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: SODCP.2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3pu7a_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn], chloroplastic
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: SODCP.2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3pu7b_
  • Heterogens: ZN, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3pu7A (A:)
atkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmst
gahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvh
eleddlgkgghelslttgnaggrlacgvvgltpi

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3pu7B (B:)
atkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmst
gahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvh
eleddlgkgghelslttgnaggrlacgvvgltpi