PDB entry 3pj6

View 3pj6 on RCSB PDB site
Description: Crystal Structures of Multidrug-Resistant Clinical Isolate 769 HIV-1 Protease Variants
Class: hydrolase
Keywords: Alternate conformations of Pro81, proline switch, Wide-open flaps, Expanded active site cavity, HYDROLASE
Deposited on 2010-11-08, released 2011-04-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.246
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv protease
    Species: Human Immunodeficiency Virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q000H7 (0-98)
      • engineered mutation (9)
      • engineered mutation (24)
      • see remark 999 (34-35)
      • see remark 999 (45)
      • see remark 999 (81)
    Domains in SCOPe 2.02: d3pj6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pj6A (A:)
    pqitlwqrpvvtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf