PDB entry 3p92

View 3p92 on RCSB PDB site
Description: Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant (BPTI-K15R/R17G)
Class: hydrolase/hydrolase inhibitor
Keywords: mesotrypsin, trypsin IV, canonical inhibitor, bovine pancreatic trypsin inibitor, BPTI, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-10-15, released 2011-08-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.115
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PRSS3 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N2U3 (0-223)
      • engineered mutation (176)
    Domains in SCOPe 2.01: d3p92a_
  • Chain 'E':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • engineered mutation (14)
      • engineered mutation (16)
    Domains in SCOPe 2.01: d3p92e_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3p92A (A:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3p92E (E:)
    rpdfcleppytgpcragiiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgga