PDB entry 3ogq

View 3ogq on RCSB PDB site
Description: Crystal Structure of 6s-98S FIV Protease with Lopinavir bound
Class: hydrolase/hydrolase inhibitor
Keywords: aspartyl protease, HIV-like FIV chimera, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-08-17, released 2011-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.228
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FIV Protease
    Species: Feline immunodeficiency virus [TaxId:11673]
    Gene: pol, PR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16088 (Start-115)
      • engineered mutation (36)
      • engineered mutation (54)
      • engineered mutation (58)
      • engineered mutation (97-99)
    Domains in SCOPe 2.06: d3ogqa_
  • Chain 'B':
    Compound: FIV Protease
    Species: Feline immunodeficiency virus [TaxId:11673]
    Gene: pol, PR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16088 (Start-115)
      • engineered mutation (36)
      • engineered mutation (54)
      • engineered mutation (58)
      • engineered mutation (97-99)
    Domains in SCOPe 2.06: d3ogqb_
  • Heterogens: AB1, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3ogqA (A:)
ynkvgttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmmigig
ggkrgtnyinvhleirdenyktqcifgnvcvlednslsvnllgrdnmikfnirlvm

    Sequence, based on observed residues (ATOM records): (download) 
    >3ogqA (A:)
gttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmmigigggkr
gtnyinvhleirdenyktqcifgnvcvlednslsvnllgrdnmikfnirlvm

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3ogqB (B:)
ynkvgttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmmigig
ggkrgtnyinvhleirdenyktqcifgnvcvlednslsvnllgrdnmikfnirlvm

    Sequence, based on observed residues (ATOM records): (download) 
    >3ogqB (B:)
gttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmmigigggkr
gtnyinvhleirdenyktqcifgnvcvlednslsvnllgrdnmikfnirlvm