PDB entry 3o9c

View 3o9c on RCSB PDB site
Description: Crystal Structure of wild-type HIV-1 Protease in complex with kd20
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, Protease inhibitors, AIDS, Aspartyl protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-08-04, released 2011-08-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.177
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: Gag-Pol, pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90K99 (0-98)
      • engineered mutation (6)
    Domains in SCOPe 2.01: d3o9ca_
  • Chain 'B':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: Gag-Pol, pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90K99 (0-98)
      • engineered mutation (6)
    Domains in SCOPe 2.01: d3o9cb_
  • Heterogens: K20, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o9cA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o9cB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf