PDB entry 3o8i

View 3o8i on RCSB PDB site
Description: Structure of 14-3-3 isoform sigma in complex with a C-Raf1 peptide and a stabilizing small molecule fragment
Class: peptide binding protein
Keywords: Protein-Protein Complex, 14-3-3, Protein-protein interaction, Phosphorylation, PEPTIDE BINDING PROTEIN
Deposited on 2010-08-03, released 2010-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-29, with a file datestamp of 2010-09-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (8-238)
      • expression tag (5-7)
    Domains in SCOPe 2.07: d3o8ia1, d3o8ia2
  • Chain 'B':
    Compound: 14-3-3 binding site peptide of RAF proto-oncogene serine/threonine-protein kinase
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: M1T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3o8iA (A:)
    gamgsmgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvv
    ggqraawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeag
    daesrvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlgl
    alnfsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3o8iA (A:)
    mgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
    awrvlssieqgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkgdy
    yrylaevatkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeianspeea
    islakttfdeamadlhtlsykdstlimqllrdnltlwt
    

  • Chain 'B':
    No sequence available.