PDB entry 3o2o

View 3o2o on RCSB PDB site
Description: Structure of E. coli ClpS ring complex
Class: peptide binding protein
Keywords: adaptor, N-end rule peptide, peptide-binding protein, PEPTIDE BINDING PROTEIN
Deposited on 2010-07-22, released 2011-12-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.175
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli [TaxId:83333]
    Gene: clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3o2oa_
  • Chain 'B':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli [TaxId:83333]
    Gene: clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3o2ob_
  • Chain 'C':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli [TaxId:83333]
    Gene: clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3o2oc_
  • Chain 'D':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli [TaxId:83333]
    Gene: clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3o2od_
  • Chain 'E':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli [TaxId:83333]
    Gene: clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3o2oe_
  • Chain 'F':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli [TaxId:83333]
    Gene: clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3o2of_
  • Chain 'G':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli [TaxId:83333]
    Gene: clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3o2og_
  • Chain 'H':
    Compound: ATP-dependent Clp protease adaptor protein clpS
    Species: Escherichia coli [TaxId:83333]
    Gene: clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3o2oh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o2oA (A:)
    lkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaeva
    etkvamvnkyarenehpllctleka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o2oB (B:)
    lkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaeva
    etkvamvnkyarenehpllctleka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o2oC (C:)
    lkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaeva
    etkvamvnkyarenehpllctleka
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o2oD (D:)
    lkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaeva
    etkvamvnkyarenehpllctleka
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o2oE (E:)
    lkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaeva
    etkvamvnkyarenehpllctleka
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o2oF (F:)
    lkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaeva
    etkvamvnkyarenehpllctleka
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o2oG (G:)
    lkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaeva
    etkvamvnkyarenehpllctleka
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3o2oH (H:)
    lkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaeva
    etkvamvnkyarenehpllctleka