PDB entry 3nxu

View 3nxu on RCSB PDB site
Description: Crystal structure of human cytochrome P4503A4 bound to an inhibitor ritonavir
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: alpha beta protein, cytochrome P450 fold, hemoprotein, monooxygenase, cytochrome P450 reductase, endoplasmic reticulum, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2010-07-14, released 2010-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A3, CYP3A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nxua_
  • Chain 'B':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A3, CYP3A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nxub_
  • Heterogens: DMS, HEM, RIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nxuA (A:)
    maygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvl
    aitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgkl
    kemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdp
    fventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrle
    dtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyela
    thpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdve
    ingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtvsg
    ahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxuA (A:)
    shglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdpd
    miktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvpi
    iaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfventk
    kllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtrvdf
    lqlmidsqnalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavl
    pnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsy
    alhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirv
    lqnfsfkpcketqiplklslggllqpekpvvlkvesr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nxuB (B:)
    maygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvl
    aitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgkl
    kemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdp
    fventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrle
    dtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyela
    thpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdve
    ingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtvsg
    ahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxuB (B:)
    shglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdpd
    miktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvpi
    iaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfventk
    kllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtrvdf
    lqlmidsqnalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavl
    pnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsy
    alhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirv
    lqnfsfkpcketqiplklslggllqpekpvvlkvesr