PDB entry 3nls

View 3nls on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease in Complex with KNI-10772
Class: hydrolase/hydrolase inhibitor
Keywords: PROTEASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-06-21, released 2011-09-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11686]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11686]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
    Domains in SCOPe 2.02: d3nlsb_
  • Heterogens: GOL, URE, 016, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nlsB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf