PDB entry 3mi8

View 3mi8 on RCSB PDB site
Description: The structure of TL1A-DCR3 COMPLEX
Class: immune system
Keywords: dcr3, tl1a, tnf, tnfr, decoy receptor, immunity, disulfide bond, glycoprotein, secreted, receptor, immune system
Deposited on 2010-04-09, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.234
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 15, secreted form
    Species: Homo sapiens [TaxId:9606]
    Gene: TL1, TNFSF15, VEGI
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95150 (Start-183)
      • engineered mutation (134)
    Domains in SCOPe 2.07: d3mi8a_
  • Chain 'D':
    Compound: Tumor necrosis factor receptor superfamily member 6B
    Species: Homo sapiens [TaxId:9606]
    Gene: DcR3, TNFRSF6B
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mi8A (A:)
    gshmlkgqefapshqqvyaplradgdkprahltvvrqtptqhfknqfpalhwehelglaf
    tknrmnytnkfllipesgdyfiysqvtfrgmtsecseirqagrpnkpdsitvvitkvtds
    ypeptqllmgtksvsevgsnwfqpiylgamfslqegdklmvnvsdislvdytkedktffg
    afll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi8A (A:)
    dkprahltvvrqtptqhfknqfpalhwehelglaftknrmnytnkfllipesgdyfiysq
    vtfrgmpdsitvvitkvtdsypeptqllmgtksvsevgsnwfqpiylgamfslqegdklm
    vnvsdislvdytkedktffgafll
    

  • Chain 'D':
    No sequence available.