PDB entry 3mck

View 3mck on RCSB PDB site
Description: Crystal structure of anti-beta-amyloid antibody C705
Class: immune system
Keywords: immunoglobulin fold, monoclonal antibody, immune system
Deposited on 2010-03-29, released 2011-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c705 monoclonal light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MCK (0-218)
    Domains in SCOPe 2.07: d3mcka1, d3mcka2
  • Chain 'B':
    Compound: c705 monoclonal heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MCK (0-End)
  • Chain 'H':
    Compound: c705 monoclonal heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MCK (0-End)
  • Chain 'L':
    Compound: c705 monoclonal light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MCK (0-218)
    Domains in SCOPe 2.07: d3mckl1, d3mckl2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mckA (A:)
    dvmmtqtplslpvslgdqasiscrssqslvhsngntylewymqkpgqspmlliykvsnrf
    sgvpdrfsgsgsgtdftlkissveaedlgvfycfqgsrvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mckL (L:)
    dvmmtqtplslpvslgdqasiscrssqslvhsngntylewymqkpgqspmlliykvsnrf
    sgvpdrfsgsgsgtdftlkissveaedlgvfycfqgsrvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec