PDB entry 3m64

View 3m64 on RCSB PDB site
Description: Human aldose reductase mutant T113V complexed with IDD393
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: T113V mutant, TIM-barrel, NADP, Phosphoprotein, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2010-03-15, released 2011-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.128
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15121 (0-315)
      • see remark 999 (4)
      • engineered mutation (113)
    Domains in SCOPe 2.08: d3m64a_
  • Heterogens: NAP, 393, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m64A (A:)
    masrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq
    eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwpvgfkpgk
    effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp
    avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak
    hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca
    llsctshkdypfheef