PDB entry 3lzs

View 3lzs on RCSB PDB site
Description: Crystal Structure of HIV-1 CRF01_AE Protease in Complex with Darunavir
Class: hydrolase
Keywords: HIV-1 protease, non-B clades, CRF01_AE, inhibitor resistance, AIDS, Aspartyl protease, HYDROLASE
Deposited on 2010-03-01, released 2010-08-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.203
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9QB59 (0-98)
    • engineered (6)
  Domains in SCOPe 2.02: d3lzsa_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9QB59 (0-98)
    • engineered (6)
  Domains in SCOPe 2.02: d3lzsb_
• Heterogens: 017, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lzsA (A:)
  pqitlwkrplvtvkiggqlkealldtgaddtvledinlpgkwkpkmiggiggfikvrqyd
  qilieicgkkaigtvlvgptpvniigrnmltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lzsB (B:)
  pqitlwkrplvtvkiggqlkealldtgaddtvledinlpgkwkpkmiggiggfikvrqyd
  qilieicgkkaigtvlvgptpvniigrnmltqigctlnf