PDB entry 3lwe

View 3lwe on RCSB PDB site
Description: The crystal structure of MPP8
Class: cell cycle
Keywords: mpp8, Structural Genomics, Structural Genomics Consortium, SGC, ANK repeat, Nucleus, Phosphoprotein, CELL CYCLE
Deposited on 2010-02-23, released 2010-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.22
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M-phase phosphoprotein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MPHOSPH8, MPP8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lwea_
  • Chain 'B':
    Compound: M-phase phosphoprotein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MPHOSPH8, MPP8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3lweb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3lweA (A:)
gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
ak

    Sequence, based on observed residues (ATOM records): (download) 
    >3lweA (A:)
gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
a

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3lweB (B:)
gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
ak

    Sequence, based on observed residues (ATOM records): (download) 
    >3lweB (B:)
gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaen