PDB entry 3lsw

View 3lsw on RCSB PDB site
Description: Aniracetam bound to the ligand binding domain of GluA3
Class: transport protein
Keywords: glutamate receptor, GluR3, GluA3, AMPA receptor, neurotransmitter receptor, S1S2, allosteric modulator, TRANSPORT PROTEIN
Deposited on 2010-02-13, released 2010-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.182
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GluA2 S1S2 domain
    Species: Rattus norvegicus, Mus musculus [TaxId:10116, 10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19492 (0-113)
      • linker (114-115)
    • Uniprot Q9Z2W9 (116-257)
    Domains in SCOPe 2.06: d3lswa_
  • Heterogens: GLU, 4MP, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lswA (A:)
    rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga
    rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies
    aedlakqteiaygtldsgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk
    skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgtpvnlavlklse
    qgildklknkwwydkgec