PDB entry 3l93

View 3l93 on RCSB PDB site
Description: Phosphopantetheine adenylyltransferase from Yersinia pestis.
Class: transferase
Keywords: structural genomics, phosphopantetheine adenylyltransferase, ATP-binding, Coenzyme A biosynthesis, Nucleotide-binding, Nucleotidyltransferase, Transferase, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2010-01-04, released 2010-01-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.177
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Yersinia pestis [TaxId:214092]
    Gene: coaD, kdtB, y0088, YPO0053, YP_0054
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZJN9 (3-161)
      • expression tag (1-2)
    Domains in SCOPe 2.01: d3l93a_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l93A (A:)
    snamitkaiypgtfdpitnghldlvtrasamfshvilaiadssskkpmftldervalakk
    vtaplknvevlgfselmaefakkhnanilvrglrsvsdfeyewqlanmnrhlmpklesvf
    lipsekwsfissslvkevarhggditpflpkpvtkallakla
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l93A (A:)
    namitkaiypgtfdpitnghldlvtrasamfshvilaiadssskkpmftldervalakkv
    taplknvevlgfselmaefakkhnanilvrglrsvsdfeyewqlanmnrhlmpklesvfl
    ipsekwsfissslvkevarhggditpflpkpvtkallakla