PDB entry 3l78

View 3l78 on RCSB PDB site
Description: The crystal structure of SMU.1142C from Streptococcus mutans UA159
Class: transcription
Keywords: transcription, transcriptional factor, STREPTOCOCCUS MUTANS, Disulfide bond, Redox-active center, Transcription regulation
Deposited on 2009-12-28, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein spx
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU.1142c (AMINO ACIDS 1-120)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3l78a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l78A (A:)
    mvtlflspsctscrkarawlnrhdvvfqehnimtsplsrdellkilsytengtediistr
    skvfqkldidvdelsvselinlisknpsllrrpiimdnkrmqigfnedeiraflprdyrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l78A (A:)
    mvtlflspsctscrkarawlnrhdvvfqehnimtsplsrdellkilsytengtediistr
    skvfqkldidvdelsvselinlisknpsllrrpiimdnkrmqigfnedeiraflprd