PDB entry 3l4n

View 3l4n on RCSB PDB site
Description: Crystal structure of yeast monothiol glutaredoxin Grx6
Class: oxidoreductase
Keywords: C-terminal domain of Grx6, OXIDOREDUCTASE
Deposited on 2009-12-21, released 2010-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.181
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monothiol glutaredoxin-6
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GRX6, YDL010W, D2890
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3l4na_
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3l4nA (A:)
fnvqkeyslildlspiiifskstcsyskgmkelleneyqfipnyyiieldkhghgeelqe
yiklvtgrgtvpnllvngvsrggneeikklhtqgklleslqvwsdgkfsveqrekpsnnl
ehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3l4nA (A:)
fnvqkeyslildlspiiifskstcsyskgmkelleneyqfipnyyiieldkhghgeelqe
yiklvtgrgtvpnllvngvsrggneeikklhtqgklleslqvwsdgkfsveqr