PDB entry 3l1m

View 3l1m on RCSB PDB site
Description: Crystal Structure of a Ni-directed Dimer of Cytochrome cb562 with a Quinolate-Histidine Hybrid Coordination Motif
Class: electron transport
Keywords: Four-Helix Bundle, V-shaped Dimer, Interfacial Nickel Coordination, Metal-binding, Periplasm, Transport, ELECTRON TRANSPORT
Deposited on 2009-12-13, released 2010-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Soluble cytochrome b562
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABE7 (0-105)
    • engineered (58)
    • engineered (69)
    • engineered (97)
    • engineered (100)
  Domains in SCOPe 2.08: d3l1ma_
• Heterogens: HEM, HQI, NI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3l1mA (A:)
  adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
  frhgfdilvcqiddalklanegkvkeaqaaaeqlkttcnachqkyr