PDB entry 3kyu

View 3kyu on RCSB PDB site
Description: X-ray crystal structure determination of fully perdeuterated rubredoxin at 100K
Class: electron transport
Keywords: Electron transport, Iron, Metal-binding, Transport
Deposited on 2009-12-07, released 2010-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: RUB, PF1282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3kyua_
  • Heterogens: FE, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3kyuA (A:)
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled