PDB entry 3krp

View 3krp on RCSB PDB site
Description: Mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium and GPP
Class: transferase
Keywords: prenyltransferase, Isoprene biosynthesis, isoprenyl pyrophosphate synthase, TRANSFERASE
Deposited on 2009-11-19, released 2010-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyl diphosphate synthase large subunit
    Species: Mentha x piperita [TaxId:34256]
    Gene: GPPS Large Subunit
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR3 (1-294)
      • expression tag (0)
    Domains in SCOPe 2.07: d3krpa1, d3krpa2
  • Chain 'B':
    Compound: Geranyl diphosphate synthase small subunit
    Species: Mentha x piperita [TaxId:34256]
    Gene: GPPS Small subunit
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR4 (1-End)
      • expression tag (0)
  • Chain 'C':
    Compound: Geranyl diphosphate synthase small subunit
    Species: Mentha x piperita [TaxId:34256]
    Gene: GPPS Small subunit
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR4 (1-End)
      • expression tag (0)
  • Chain 'D':
    Compound: Geranyl diphosphate synthase large subunit
    Species: Mentha x piperita [TaxId:34256]
    Gene: GPPS Large Subunit
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SBR3 (1-294)
      • expression tag (0)
    Domains in SCOPe 2.07: d3krpd1, d3krpd2
  • Heterogens: PPV, MG, EDO, GPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3krpA (A:)
    mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
    destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
    fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
    taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkd
    lvadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krpA (A:)
    mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
    destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
    fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
    taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtkkttypkligvek
    skefadrlnreaqeqllhfhphraaplialanyiayrdn
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3krpD (D:)
    mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
    destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
    fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
    taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkd
    lvadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3krpD (D:)
    mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
    destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
    fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
    taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktypkl
    igvekskefadrlnreaqeqllhfhphraaplialanyiayrdn