PDB entry 3knb

View 3knb on RCSB PDB site
Description: Crystal structure of the titin C-terminus in complex with obscurin-like 1
Class: structural protein/structural protein
Keywords: Ig-like, titin, obscurin, obsl1, ATP-binding, Calmodulin-binding, Cardiomyopathy, Disease mutation, Immunoglobulin domain, Kinase, Limb-girdle muscular dystrophy, Magnesium, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase, STRUCTURAL PROTEIN-STRUCTURAL PROTEIN complex
Deposited on 2009-11-12, released 2009-12-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.165
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZ42 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3knba_
  • Chain 'B':
    Compound: Obscurin-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0657, OBSL1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3knbA (A:)
gpgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientd
dlttliimdvqkqdgglytlslgnefgsdsatvnihirsi

    Sequence, based on observed residues (ATOM records): (download) 
    >3knbA (A:)
pgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientdd
lttliimdvqkqdgglytlslgnefgsdsatvnihirs

  • Chain 'B':
    No sequence available.