SCOPe 2.06: Structural Classification of Proteins

PDB entry 3kip

View 3kip on RCSB PDB site
Description: Crystal structure of type-II 3-dehydroquinase from C. albicans
Class: lyase
Keywords: lyase
Deposited on 2009-11-02, released 2010-05-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.205
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158)
Domains in SCOPe 2.06: d3kipa1, d3kipa2, d3kipa3
Chain 'B':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158)
Domains in SCOPe 2.06: d3kipb1, d3kipb2, d3kipb3
Chain 'C':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158)
Domains in SCOPe 2.06: d3kipc1, d3kipc2, d3kipc3
Chain 'D':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (11-12)
  - expression tag (158)
Domains in SCOPe 2.06: d3kipd1, d3kipd2, d3kipd3
Chain 'E':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (11-12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kipe1, d3kipe2, d3kipe3
Chain 'F':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (11-12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kipf1, d3kipf2, d3kipf3
Chain 'G':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158)
Domains in SCOPe 2.06: d3kipg1, d3kipg2, d3kipg3
Chain 'H':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kiph1, d3kiph2, d3kiph3
Chain 'I':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158)
Domains in SCOPe 2.06: d3kipi1, d3kipi2, d3kipi3
Chain 'J':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158)
Domains in SCOPe 2.06: d3kipj1, d3kipj2, d3kipj3
Chain 'K':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kipk1, d3kipk2, d3kipk3
Chain 'L':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kipl1, d3kipl2, d3kipl3
Chain 'M':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kipm1, d3kipm2, d3kipm3
Chain 'N':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kipn1, d3kipn2, d3kipn3
Chain 'O':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kipo1, d3kipo2, d3kipo3
Chain 'P':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kipp1, d3kipp2, d3kipp3
Chain 'Q':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kipq1, d3kipq2, d3kipq3
Chain 'R':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kipr1, d3kipr2, d3kipr3
Chain 'S':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kips1, d3kips2, d3kips3
Chain 'T':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (11-12)
  - expression tag (158)
Domains in SCOPe 2.06: d3kipt1, d3kipt2, d3kipt3
Chain 'U':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158)
Domains in SCOPe 2.06: d3kipu1, d3kipu2, d3kipu3
Chain 'V':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (12)
  - expression tag (158)
Domains in SCOPe 2.06: d3kipv1, d3kipv2, d3kipv3
Chain 'W':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (11-12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kipw1, d3kipw2, d3kipw3
Chain 'X':
Compound: 3-dehydroquinase, type II
Species: Candida albicans [TaxId:5476]
Gene: DQD1, DHQ99, CaO19.9823
Database cross-references and differences (RAF-indexed):
- Uniprot Q59Z17 (13-157)
  - expression tag (11-12)
  - expression tag (158-159)
Domains in SCOPe 2.06: d3kipx1, d3kipx2, d3kipx3
Heterogens: SO4, TRS, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3kipA (A:)
ahhhhhhghhhqlvkkvllingpnlnllgtrepekygttslsdieqaaieqaklknndse
vlvfqsntegfiidriheakrqgvgfvvinagaythtsvgirdallgtaipfievhitnv
hqrepfrhqsylsdkavavicglgvygytaaieyalnyqldgdleaa