PDB entry 3ivb

View 3ivb on RCSB PDB site
Description: Structures of SPOP-Substrate Complexes: Insights into Architectures of BTB-Cul3 Ubiquitin Ligases: SPOPMATH-MacroH2ASBCpep1
Class: protein binding, ligase
Keywords: Protein Binding/Hydrolase, Nucleus, Ubl conjugation pathway, Alternative splicing, Chromatin regulator, Chromosomal protein, DNA-binding, Isopeptide bond, Methylation, Nucleosome core, Phosphoprotein, Ubl conjugation, protein binding, ligase
Deposited on 2009-08-31, released 2009-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.22
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Speckle-type POZ protein
  Species: Homo sapiens [TaxId:9606]
  Gene: SPOP
  Database cross-references and differences (RAF-indexed):
  • Uniprot O43791 (6-End)
  Domains in SCOPe 2.08: d3ivba_
• Chain 'M':
  Compound: Core histone macro-H2A.1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75367
• Heterogens: ZN, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3ivbA (A:)
  gsggsgkvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeesk
  dylslylllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdf
  lldeangllpddkltlfcevsvvqd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3ivbA (A:)
  kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
  lllvscpkevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldeang
  llpddkltlfcevsvvq
  

  
  
• Chain 'M':
  No sequence available.