PDB entry 3ilz

View 3ilz on RCSB PDB site
Description: Structure of TR-alfa bound to selective thyromimetic GC-1 in P212121 space group
Class: signaling protein
Keywords: nuclear receptor, SIGNALING PROTEIN
Deposited on 2009-08-07, released 2010-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.152
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thyroid hormone receptor, alpha isoform 1 variant
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59FW3 (4-266)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d3ilza1, d3ilza2
  • Heterogens: B72, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ilzA (A:)
gshmeemirslqqrpeptpeewdlihiateahrstnaqgshwkqrrkflpddigqspivs
mpdgdkvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslra
avrydpesdtltlsgemavkreqlkngglgvvsdaifelgkslsafnlddtevallqavl
lmstdrsgllcvdkieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigachas
rflhmkvecptelfpplflevfedqev