PDB entry 3i8z

View 3i8z on RCSB PDB site
Description: Crystal structure of human chromobox homolog 4 (CBX4)
Class: transcription
Keywords: chromobox homolog 4, CBX4, Structural Genomics, Structural Genomics Consortium, SGC, Alternative splicing, Chromatin regulator, Isopeptide bond, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation, Ubl conjugation, Ubl conjugation pathway
Deposited on 2009-07-10, released 2009-08-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.229
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 SUMO-protein ligase CBX4
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3i8za_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i8zA (A:)
    ehvfavesiekkrirkgrveylvkwrgwspkyntwepeenildprlliafqnrer
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i8zA (A:)
    favesiekkrirkgrveylvkwrgwspkyntwepeenildprlliafqnr