PDB entry 3i7w

View 3i7w on RCSB PDB site
Description: High pressure structure of wild-type RNase A (0.67 GPa)
Class: Hydrolase
Keywords: ribonuclease A, RNase A, high pressure, Disulfide bond, Endonuclease, Glycation, Glycoprotein, Hydrolase, Nuclease, Secreted
Deposited on 2009-07-09, released 2009-08-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.252
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease pancreatic
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
  Domains in SCOPe 2.05: d3i7wa_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3i7wA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv