PDB entry 3i5f

View 3i5f on RCSB PDB site
Description: Crystal structure of squid MG.ADP myosin S1
Class: contractile protein
Keywords: SQUID, POST-RIGOR STATE, MG.ADP, MYOSIN II S1, CONTRACTILE PROTEIN, ATP-binding, Actin-binding, Coiled coil, Motor protein, Muscle protein, Myosin, Nucleotide-binding, Thick filament, Calcium
Deposited on 2009-07-05, released 2009-08-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.244
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin heavy chain isoform A
    Species: Loligo pealei [TaxId:6621]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O44934 (0-838)
      • conflict (237)
      • conflict (743)
  • Chain 'B':
    Compound: Myosin regulatory light chain LC-2, mantle muscle
    Species: Todarodes pacificus [TaxId:6637]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3i5fb_
  • Chain 'C':
    Compound: Myosin catalytic light chain LC-1, mantle muscle
    Species: Todarodes pacificus [TaxId:6637]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3i5fc_
  • Heterogens: MG, ADP

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3i5fB (B:)
aeeaprrvklsqrqmqelkeaftmidqdrdgfigmedlkdmfsslgrvppddelnamlke
cpgqlnftafltlfgekvsgtdpedalrnafsmfdedgqgfipedylkdllenmgdnfsk
eeiknvwkdaplknkqfnynkmvdikgkaeded

    Sequence, based on observed residues (ATOM records): (download) 
    >3i5fB (B:)
rvklsqrqmqelkeaftmidqdrdgfigmedlkdmfsslgrvppddelnamlkecpgqln
ftafltlfgekvsgtdpedalrnafsmfdedgqgfipedylkdllenmgdnfskeeiknv
wkdaplknkqfnynkmvdikgkaed

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3i5fC (C:)
sqltkdeieevrevfdlfdfwdgrdgdvdaakvgdllrclgmnpteaqvhqhggtkkmge
kaykleeilpiyeemsskdtgtaadefmeafktfdregqglissaeirnvlkmlgerite
dqcndiftfcdiredidgnikyedlmkkvmagpfpdksd