PDB entry 3i4o

View 3i4o on RCSB PDB site
Description: Crystal Structure of Translation Initiation Factor 1 from Mycobacterium tuberculosis
Class: translation
Keywords: translation initiation, IF1, Initiation factor, Protein biosynthesis, TRANSLATION
Deposited on 2009-07-02, released 2010-02-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor IF-1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: infA, MCB1222.32c, MT3568, MTCY13E12.15c, Rv3462c, Rv3462c (infA)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i4oa_
  • Chain 'B':
    Compound: Translation initiation factor IF-1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: infA, MCB1222.32c, MT3568, MTCY13E12.15c, Rv3462c, Rv3462c (infA)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3i4ob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3i4oA (A:)
gidpftmakkdgaievegrvveplpnamfrielenghkvlahisgkmrqhyirilpedrv
vvelspydlsrgrivyryk

    Sequence, based on observed residues (ATOM records): (download) 
    >3i4oA (A:)
gaievegrvveplpnamfrielenghkvlahisgkmrqhyirilpedrvvvelspydlsr
grivyryk

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3i4oB (B:)
gidpftmakkdgaievegrvveplpnamfrielenghkvlahisgkmrqhyirilpedrv
vvelspydlsrgrivyryk

    Sequence, based on observed residues (ATOM records): (download) 
    >3i4oB (B:)
aievegrvveplpnamfrielenghkvlahisgkmrqhyirilpedrvvvelspydlsrg
rivyryk