PDB entry 3hax

View 3hax on RCSB PDB site
Description: Crystal structure of a substrate-bound Gar1-minus H/ACA RNP from Pyrococcus furiosus
Class: isomerase/biosynthetic protein/RNA
Keywords: H/ACA, guide RNA, RNA-protein complex, pseudouridine synthase, Isomerase, tRNA processing, Ribonucleoprotein, Ribosome biogenesis, rRNA processing, Ribosomal protein, RNA-binding, ISOMERASE-BIOSYNTHETIC PROTEIN-RNA COMPLEX
Deposited on 2009-05-03, released 2009-06-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.204
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable tRNA pseudouridine synthase B
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: truB, PF1785
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ribosome biogenesis protein Nop10
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1141
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3haxc_
  • Chain 'D':
    Compound: 50S ribosomal protein L7Ae
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rpl7ae, PF1367
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: h/aca RNA
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 5'-r(*ap*up*ap*ap*up*up*(fhu)p*gp*ap*cp*up*cp*ap*a)-3'
  • Heterogens: PGE, EDO, ZN, PG4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >3haxC (C:)
mkfrirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgigrkek

    Sequence, based on observed residues (ATOM records): (download) 
    >3haxC (C:)
frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.