PDB entry 3h8m

View 3h8m on RCSB PDB site
Description: SAM domain of human ephrin type-a receptor 7 (EPHA7)
Class: transferase
Keywords: SAM DOMAIN, KINASE,STRUCTURAL GENOMICS, STRUCTURAL GENOMICS CONSORTIUM, SGC, Alternative splicing, ATP-binding, Glycoprotein, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2009-04-29, released 2009-05-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 7
    Species: Homo sapiens [TaxId:9606]
    Gene: EHK3, EPHA7, HEK11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3h8ma_
  • Chain 'B':
    Compound: Ephrin type-A receptor 7
    Species: Homo sapiens [TaxId:9606]
    Gene: EHK3, EPHA7, HEK11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15375 (18-89)
      • expression tag (11-17)
    Domains in SCOPe 2.06: d3h8mb1, d3h8mb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3h8mA (A:)
mhhhhhhssgrenlyfqgtpdfttfcsvgewlqaikmerykdnftaagynslesvarmti
edvmslgitlvghqkkimssiqtmraqmlh

    Sequence, based on observed residues (ATOM records): (download) 
    >3h8mA (A:)
tpdfttfcsvgewlqaikmerykdnftaagynslesvarmtiedvmslgitlvghqkkim
ssiqtmraqml

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3h8mB (B:)
mhhhhhhssgrenlyfqgtpdfttfcsvgewlqaikmerykdnftaagynslesvarmti
edvmslgitlvghqkkimssiqtmraqmlh

    Sequence, based on observed residues (ATOM records): (download) 
    >3h8mB (B:)
enlyfqgtpdfttfcsvgewlqaikmerykdnftaagynslesvarmtiedvmslgitlv
ghqkkimssiqtmraqmlh