PDB entry 3h34

View 3h34 on RCSB PDB site
Description: PpcE, A cytochrome c7 from Geobacter sulfurreducens
Class: electron transport
Keywords: cytochrome c7, Multiheme cytochrome, Geobacter sulfurreducens, electron transport
Deposited on 2009-04-15, released 2009-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c7
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: cyd-5, GSU1760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3h34a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3h34A (A:)
advilfpskngavtfthkrhsefvrecrschektpgkirnfgkdyahktckgchevrgag
ptkcklchtg