PDB entry 3grx

View 3grx on RCSB PDB site
Description: nmr structure of escherichia coli glutaredoxin 3-glutathione mixed disulfide complex, 20 structures
Class: electron transport
Keywords: electron transport, thiol-disulfide oxidoreductase, thioltransferase, thioredoxin superfamily
Deposited on 1998-08-17, released 1999-03-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin 3
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AC62 (0-81)
      • mutation (13)
      • mutation (64)
    Domains in SCOPe 2.05: d3grxa_
  • Heterogens: GSH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3grxA (A:)
anveiytketcpyshrakallsskgvsfqelpidgnaakreemikrsgrttvpqifidaq
higgyddlyaldarggldpllk