PDB entry 3gi5
View 3gi5 on RCSB PDB site
Description: Crystal structure of protease inhibitor, KB62 in complex with wild type HIV-1 protease
Class: hydrolase/hydrolase inhibitor
Keywords: Drug design, protease inhibitors, HIV-1 protease, Aspartyl protease, Hydrolase, Protease, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on
2009-03-05, released
2010-03-09
The last revision prior to the SCOPe 2.01 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.171
AEROSPACI score: 0.54
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d3gi5a_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d3gi5b_ - Heterogens: K62, PO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3gi5A (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3gi5B (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf