PDB entry 3fqc

View 3fqc on RCSB PDB site
Description: Staphylococcus aureus dihydrofolate reductase complexed with NADPH and 2,4-diamino-5-[3-(3,4,5-trimethoxyphenyl)pent-1-ynyl]-6-methylpyrimidine (UCP115A)
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2009-01-07, released 2009-03-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Trimethoprim-sensitive dihydrofolate reductase
  Species: Staphylococcus aureus RF122 [TaxId:273036]
  Gene: dfrB, SAB1281c
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2YY41 (0-156)
  Domains in SCOPe 2.08: d3fqca_
• Chain 'B':
  Compound: Trimethoprim-sensitive dihydrofolate reductase
  Species: Staphylococcus aureus RF122 [TaxId:273036]
  Gene: dfrB, SAB1281c
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2YY41 (0-156)
  Domains in SCOPe 2.08: d3fqcb_
• Heterogens: NDP, 55V, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fqcA (A:)
  tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
  vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
  tffppytfedwevassvegkldekntiphtflhlirk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fqcB (B:)
  tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
  vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
  tffppytfedwevassvegkldekntiphtflhlirk