PDB entry 3f3m

View 3f3m on RCSB PDB site
Description: Six Crystal Structures of Two Phosphopantetheine Adenylyltransferases Reveal an Alternative Ligand Binding Mode and an Associated Structural Change
Class: transferase
Keywords: Phosphopantetheine adenylyltransferase, PPAT, Coenzyme A biosynthetic pathway, Coenzyme A biosynthesis, Nucleotidyltransferase, TRANSFERASE
Deposited on 2008-10-31, released 2009-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3f3ma_
  • Heterogens: PPS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3f3mA (A:)
mehtiavipgsfdpityghldiierstdrfdeihvcvlknskkegtfsleermdlieqsv
khlpnvkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymm
sstnysfisssivkevaayradisefvppyvekalkkkfklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3f3mA (A:)
mehtiavipgsfdpityghldiierstdrfdeihvcvlkgtfsleermdlieqsvkhlpn
vkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymmsstny
sfisssivkevaayradisefvppyvekalkkkfk