PDB entry 3ex7

View 3ex7 on RCSB PDB site
Description: The crystal structure of EJC in its transition state
Class: hydrolase/RNA binding protein/RNA
Keywords: PROTEIN-RNA COMPLEX, mRNA processing, mRNA splicing, mRNA transport, Nonsense-mediated mRNA decay, Nucleus, RNA-binding, Spliceosome, Transport, Alternative splicing, Cytoplasm, Phosphoprotein, Acetylation, ATP-binding, Helicase, Hydrolase, Nucleotide-binding, rRNA processing, Coiled coil, hydrolase/RNA binding protein/RNA COMPLEX
Deposited on 2008-10-16, released 2008-12-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-01-13, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein mago nashi homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: MAGOH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ex7a_
  • Chain 'B':
    Compound: RNA-binding protein 8A
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM8A
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Eukaryotic initiation factor 4A-III
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF4A3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38919 (Start-410)
      • expression tag (411-412)
  • Chain 'D':
    Compound: Protein CASC3
    Species: Homo sapiens [TaxId:9606]
    Gene: CASC3
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Protein mago nashi homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: MAGOH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ex7e_
  • Chain 'F':
    Compound: RNA (5'-r(*up*up*up*up*up*u)-3')
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: RNA-binding protein 8A
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM8A
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Eukaryotic initiation factor 4A-III
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF4A3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38919 (Start-410)
      • expression tag (411-412)
  • Chain 'I':
    Compound: Protein CASC3
    Species: Homo sapiens [TaxId:9606]
    Gene: CASC3
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: RNA (5'-r(*up*up*up*up*up*u)-3')
    Species: synthetic, synthetic
  • Heterogens: ADP, AF3, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ex7A (A:)
    mesdfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeel
    kriiddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglr
    vfyylvqdlkclvfsliglhfkikpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ex7A (A:)
    sdfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkr
    iiddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvf
    yylvqdlkclvfsliglhfkikpi
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ex7E (E:)
    mesdfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeel
    kriiddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglr
    vfyylvqdlkclvfsliglhfkikpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ex7E (E:)
    fylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkrii
    ddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvfyy
    lvqdlkclvfsliglhfkikpi
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.