PDB entry 3egf

View 3egf on RCSB PDB site
Description: solution structure of murine epidermal growth factor determined by nmr spectroscopy and refined by energy minimization with restraints
Class: growth factor
Keywords: growth factor
Deposited on 1992-08-30, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epidermal growth factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3egfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3egfA (A:)
    nsypgcpssydgyclnggvcmhiesldsytcncvigysgdrcqtrdlrwwelr