PDB entry 3ebz

View 3ebz on RCSB PDB site
Description: High Resolution HIV-2 Protease Structure in Complex with Clinical Drug Darunavir
Class: hydrolase
Keywords: HIV-2, aspartic protease, inhibitor,protease-drug complex, HYDROLASE
Deposited on 2008-08-28, released 2008-09-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.138
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus type 2 (ISOLATE ROD) [TaxId:11720]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04584
  Domains in SCOPe 2.05: d3ebza_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus type 2 (ISOLATE ROD) [TaxId:11720]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04584 (0-98)
  Domains in SCOPe 2.05: d3ebzb_
• Heterogens: IMD, ZN, CL, NA, 017, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ebzA (A:)
  pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
  nveievlnkkvratimtgdtpinifgrniltalgmslnl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ebzB (B:)
  pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
  nveievlnkkvratimtgdtpinifgrniltalgmslnl