PDB entry 3dk1
View 3dk1 on RCSB PDB site
Description: Wild Type HIV-1 Protease with potent Antiviral inhibitor GRL-0105A
Class: hydrolase
Keywords: HIV-1, wild type protease, protease inhibitor, HYDROLASE, AIDS, Aspartyl protease, Capsid maturation, Capsid protein, Cytoplasm, DNA integration, DNA recombination, DNA-directed DNA polymerase, Endonuclease, Lipoprotein, Magnesium, Metal-binding, Multifunctional enzyme, Myristate, Nuclease, Nucleotidyltransferase, Nucleus, Phosphoprotein, Protease, Ribosomal frameshifting, RNA-binding, RNA-directed DNA polymerase, Transferase, Viral nucleoprotein, Virion, Zinc, Zinc-finger
Deposited on
2008-06-24, released
2009-05-12
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-05-12, with a file datestamp of
2009-05-08.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.152
AEROSPACI score: 0.94
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus type 1 [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367
- engineered (6)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.02: d3dk1a_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus type 1 [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (6)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.02: d3dk1b_ - Heterogens: NA, CL, G05, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3dk1A (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3dk1B (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf