PDB entry 3dib

View 3dib on RCSB PDB site
Description: Crystal structure of bovine pancreatic ribonuclease A variant (I106A)
Class: hydrolase
Keywords: ribonuclease, RNase A, hydrolase, Bovine pancreas, Endonuclease, Glycation, Glycoprotein, Nuclease, Secreted
Deposited on 2008-06-20, released 2008-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease pancreatic
  Species: Bos taurus [TaxId:9913]
  Gene: RNASE1, RNS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
    • engineered (105)
  Domains in SCOPe 2.08: d3diba_
• Heterogens: CL, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3dibA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhaivacegnpyvpvhf
  dasv