PDB entry 3d65

View 3d65 on RCSB PDB site
Description: Crystal structure of Textilinin-1, a Kunitz-type serine protease inhibitor from the Australian Common Brown snake venom, in complex with trypsin
Class: hydrolase inhibitor/hydrolase
Keywords: Serine protease inhibitor, trypsin, blood, coagulation, Calcium, Digestion, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen, HYDROLASE INHIBITOR/HYDROLASE COMPLEX
Deposited on 2008-05-19, released 2009-06-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.214
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3d65e_
  • Chain 'I':
    Compound: Textilinin
    Species: Pseudonaja textilis textilis [TaxId:169397]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3d65i_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3d65E (E:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'I':
    Sequence, based on SEQRES records: (download) 
    >3d65I (I:)
rpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestcaa

    Sequence, based on observed residues (ATOM records): (download) 
    >3d65I (I:)
rpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestca