PDB entry 3d3t

View 3d3t on RCSB PDB site
Description: Crystal Structure of HIV-1 CRF01_AE in complex with the substrate p1-p6
Class: hydrolase
Keywords: HIV-1 protease, non-B clades, CRF01_AE, p1-p6 substrate, AIDS, Aspartyl protease, HYDROLASE
Deposited on 2008-05-12, released 2008-07-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.203
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90VT5 (0-98)
    • engineered (24)
  Domains in SCOPe 2.02: d3d3ta_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90VT5 (0-98)
    • engineered (24)
  Domains in SCOPe 2.02: d3d3tb_
• Chain 'P':
  Compound: p1-p6 substrate peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12495 (Start-9)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3d3tA (A:)
  pqitlwqrplvtikiggqlreallntgaddtvledinlpgkwkpkmiggiggfikvrqyd
  qilieicgkkaigtvlvgptpvniigrnmltqlgctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3d3tB (B:)
  pqitlwqrplvtikiggqlreallntgaddtvledinlpgkwkpkmiggiggfikvrqyd
  qilieicgkkaigtvlvgptpvniigrnmltqlgctlnf
  

  
  
• Chain 'P':
  No sequence available.