PDB entry 3d32

View 3d32 on RCSB PDB site
Description: Complex of GABA(A) receptor-associated protein (GABARAP) with a synthetic peptide
Class: transport protein
Keywords: alpha-beta, beta-grasp fold, Cytoskeleton, Golgi apparatus, Membrane, Microtubule, Transport, TRANSPORT PROTEIN
Deposited on 2008-05-09, released 2008-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.178
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95166 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d3d32a2, d3d32a3
  • Chain 'B':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3d32b_
  • Chain 'C':
    Compound: K1 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3D32 (0-11)
  • Chain 'D':
    Compound: K1 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3D32 (0-11)
  • Heterogens: NA, CL, NH2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3d32A (A:)
gsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvg
qfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl

    Sequence, based on observed residues (ATOM records): (download) 
    >3d32A (A:)
gsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvg
qfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvyg

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3d32B (B:)
gsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvg
qfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl

    Sequence, based on observed residues (ATOM records): (download) 
    >3d32B (B:)
mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvyg

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.