PDB entry 3cup

View 3cup on RCSB PDB site
Description: Crystal structure of the MHC class II molecule I-Ag7 in complex with the peptide GAD221-235
Class: immune system
Keywords: Histocompatability antigen, MHC class II, I-Ag7, Glycoprotein, Immune response, Membrane, MHC II, Transmembrane, IMMUNE SYSTEM
Deposited on 2008-04-16, released 2009-04-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: 0.235
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class II histocompatibility antigen, A-D alpha chain
    Species: MUS MUSCULUS
    Gene: H2-Aa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04228 (Start-181)
      • expression tag (182-184)
    Domains in SCOPe 2.05: d3cupa1, d3cupa2
  • Chain 'B':
    Compound: MHC class II H2-IA-beta chain linked to GAD221-235 peptide
    Species: MUS MUSCULUS
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • PDB 3CUP
    • Uniprot Q31135 (Start-213)
  • Heterogens: NAG, EPE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3cupA (A:)
eddieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfep
qgglqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppv
initwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlk
hwssadlvpr

    Sequence, based on observed residues (ATOM records): (download) 
    >3cupA (A:)
ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
lqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvini
twlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhws
sa

  • Chain 'B':
    No sequence available.