PDB entry 3bi8

View 3bi8 on RCSB PDB site
Description: Structure of Dihydrodipicolinate synthase from Clostridium botulinum
Class: lyase
Keywords: TIM-barrel, dihydrodipicolinate synthase, Amino-acid biosynthesis, Cytoplasm, Diaminopimelate biosynthesis, Lyase, Lysine biosynthesis, Schiff base
Deposited on 2007-11-30, released 2008-12-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.143
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrodipicolinate synthase
    Species: Clostridium botulinum [TaxId:1491]
    Gene: dapA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bi8a_
  • Heterogens: MLT, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bi8A (A:)
sifkgsgvaiitpftntgvdfdklseliewhiksktdaiivcgttgeattmteterketi
kfvidkvnkripviagtgsnntaasiamskwaesigvdgllvitpyynkttqkglvkhfk
avsdavstpiiiynvpgrtglnitpgtlkelcedknivavkeasgnisqiaqikalcgdk
ldiysgnddqiipilalggigvisvlanvipedvhnmcelylngkvnealkiqldslalt
nalfietnpipvktamnlmnmkvgdlrlplcemnennleilkkelkaynlm